RBBP4 antibody (70R-5611)

Rabbit polyclonal RBBP4 antibody raised against the N terminal of RBBP4

Synonyms Polyclonal RBBP4 antibody, Anti-RBBP4 antibody, RBBP4, RBBP 4 antibody, Retinoblastoma Binding Protein 4 antibody, RBBP-4 antibody, NURF55 antibody, RBAP48 antibody, RBBP 4, RBBP-4
Specificity RBBP4 antibody was raised against the N terminal of RBBP4
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RBBP4 antibody was raised using the N terminal of RBBP4 corresponding to a region with amino acids HTSDEQNHLVIASVQLPNDDAQFDASHYDSEKGEFGGFGSVSGKIEIEIK
Assay Information RBBP4 Blocking Peptide, catalog no. 33R-3865, is also available for use as a blocking control in assays to test for specificity of this RBBP4 antibody

Images

Western Blot analysis using RBBP4 antibody (70R-5611)

RBBP4 antibody (70R-5611) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBBP4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a ubiquitously expressed nuclear protein which belongs to a highly conserved subfamily of WD-repeat proteins. It is present in protein complexes involved in histone acetylation and chromatin assembly.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RBBP4 antibody (70R-5611) | RBBP4 antibody (70R-5611) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors