RBM22 antibody (70R-4781)

Rabbit polyclonal RBM22 antibody raised against the middle region of RBM22

Synonyms Polyclonal RBM22 antibody, Anti-RBM22 antibody, RBM-22, ZC3H16 antibody, RBM22, FLJ10290 antibody, RBM 22, RNA Binding Motif Protein 22 antibody, RBM 22 antibody, RBM-22 antibody
Specificity RBM22 antibody was raised against the middle region of RBM22
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RBM22 antibody was raised using the middle region of RBM22 corresponding to a region with amino acids HFYQFGEIRTITVVQRQQCAFIQFATRQAAEVAAEKSFNKLIVNGRRLNV
Assay Information RBM22 Blocking Peptide, catalog no. 33R-3732, is also available for use as a blocking control in assays to test for specificity of this RBM22 antibody


Western Blot analysis using RBM22 antibody (70R-4781)

RBM22 antibody (70R-4781) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM22 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM22 may be involved in pre-mRNA splicing.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RBM22 antibody (70R-4781) | RBM22 antibody (70R-4781) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors