RBM22 antibody (70R-4782)

Rabbit polyclonal RBM22 antibody raised against the C terminal of RBM22

Synonyms Polyclonal RBM22 antibody, Anti-RBM22 antibody, RBM 22, FLJ10290 antibody, RBM 22 antibody, RBM22, RBM-22 antibody, RBM-22, RNA Binding Motif Protein 22 antibody
Specificity RBM22 antibody was raised against the C terminal of RBM22
Cross Reactivity Human,Mouse,Rat,Dog
Applications IHC, WB
Immunogen RBM22 antibody was raised using the C terminal of RBM22 corresponding to a region with amino acids KWGRSQAARGKEKEKDGTTDSGIKLEPVPGLPGALPPPPAAEEEASANYF
Assay Information RBM22 Blocking Peptide, catalog no. 33R-4730, is also available for use as a blocking control in assays to test for specificity of this RBM22 antibody

Images

Immunohistochemical staining using RBM22 antibody (70R-4782)

RBM22 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM22 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM22 may be involved in pre-mRNA splicing.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Immunohistochemical staining using RBM22 antibody (70R-4782) | RBM22 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Myocardial cells (arrows) in Human Heart. Magnification is at 400X.
  • Western Blot analysis using RBM22 antibody (70R-4782) | RBM22 antibody (70R-4782) used at 0.25 ug/ml to detect target protein.
  • Immunohistochemical staining using RBM22 antibody (70R-4782) | RBM22 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Skeletal muscle cells (arrows) in Human Muscle. Magnification is at 400X

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors