RBM35A antibody (70R-1019)

Rabbit polyclonal RBM35A antibody raised against the N terminal of RBM35A

Synonyms Polyclonal RBM35A antibody, Anti-RBM35A antibody, RBM 35, RNA Binding Motif Protein 35A antibody, RBM35, RBM 35 antibody, RBM-35 antibody, RBM-35, FLJ20171 antibody
Specificity RBM35A antibody was raised against the N terminal of RBM35A
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen RBM35A antibody was raised using the N terminal of RBM35A corresponding to a region with amino acids MTEYLNFEKSSSVSRYGASQVEDMGNIILAMISEPYNHRFSDPERVNYKF
Assay Information RBM35A Blocking Peptide, catalog no. 33R-6542, is also available for use as a blocking control in assays to test for specificity of this RBM35A antibody


Western Blot analysis using RBM35A antibody (70R-1019)

RBM35A antibody (70R-1019) used at 5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 68 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RBM35A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM35A functions as a tumor suppressor in colon cancer cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RBM35A antibody (70R-1019) | RBM35A antibody (70R-1019) used at 5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors