RBM42 antibody (70R-4966)

Rabbit polyclonal RBM42 antibody raised against the C terminal of RBM42

Synonyms Polyclonal RBM42 antibody, Anti-RBM42 antibody, RBM-42 antibody, RNA Binding Motif Protein 42 antibody, RBM 42 antibody, RBM42, RBM-42, RBM 42, MGC10433 antibody
Specificity RBM42 antibody was raised against the C terminal of RBM42
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen RBM42 antibody was raised using the C terminal of RBM42 corresponding to a region with amino acids DPSDYVRAMREMNGKYVGSRPIKLRKSMWKDRNLDVVRKKQKEKKKLGLR
Assay Information RBM42 Blocking Peptide, catalog no. 33R-2115, is also available for use as a blocking control in assays to test for specificity of this RBM42 antibody


Western Blot analysis using RBM42 antibody (70R-4966)

RBM42 antibody (70R-4966) used at 0.5 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 50 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBM42 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBM42 belongs to the RRM RBM42 family and it contains 1 RRM (RNA recognition motif) domain. The functions of RBM42 remain unknown.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RBM42 antibody (70R-4966) | RBM42 antibody (70R-4966) used at 0.5 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors