RBMS1 antibody (70R-1624)

Rabbit polyclonal RBMS1 antibody raised against the C terminal of RBMS1

Synonyms Polyclonal RBMS1 antibody, Anti-RBMS1 antibody, RBMS-1 antibody, RBMS-1, RBMS 1 antibody, RBMS1, RBMS 1, RNA Binding Motif Single Stranded Interacting Protein 1 antibody
Specificity RBMS1 antibody was raised against the C terminal of RBMS1
Cross Reactivity Human,Mouse,Dog
Applications IHC, WB
Immunogen RBMS1 antibody was raised using the C terminal of RBMS1 corresponding to a region with amino acids TYMPATSAMQGAYLPQYAHMQTTAVPVEEASGQQQVAVETSNDHSPYTFQ
Assay Information RBMS1 Blocking Peptide, catalog no. 33R-9396, is also available for use as a blocking control in assays to test for specificity of this RBMS1 antibody


Immunohistochemical staining using RBMS1 antibody (70R-1624)

RBMS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RBMS1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBMS1 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2, originally described in RNA binding proteins, and required for DNA binding. These proteins have been implicated in such diverse functions as DNA replication, gene transcription, cell cycle progression and apoptosis.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using RBMS1 antibody (70R-1624) | RBMS1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Squamous epithelial cells (arrows) in Human Skin. Magnification is at 400X
  • Western Blot analysis using RBMS1 antibody (70R-1624) | RBMS1 antibody (70R-1624) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors