RBMS3 antibody (70R-4803)

Rabbit polyclonal RBMS3 antibody raised against the middle region of RBMS3

Synonyms Polyclonal RBMS3 antibody, Anti-RBMS3 antibody, RBMS-3, RBMS-3 antibody, RBMS 3, RBMS 3 antibody, RNA Binding Motif Single Stranded Interacting Protein 3 antibody, RBMS3
Specificity RBMS3 antibody was raised against the middle region of RBMS3
Cross Reactivity Human
Applications WB
Immunogen RBMS3 antibody was raised using the middle region of RBMS3 corresponding to a region with amino acids PTAVSIEGVVADTSPQTVAPSSQDTSGQQQQIAVDTSNEHAPAYSYQQSK
Assay Information RBMS3 Blocking Peptide, catalog no. 33R-7382, is also available for use as a blocking control in assays to test for specificity of this RBMS3 antibody

Images

Western Blot analysis using RBMS3 antibody (70R-4803)

RBMS3 antibody (70R-4803) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 46 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RBMS3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RBMS3 is a member of a small family of proteins which bind single stranded DNA/RNA. These proteins are characterized by the presence of two sets of ribonucleoprotein consensus sequence (RNP-CS) that contain conserved motifs, RNP1 and RNP2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RBMS3 antibody (70R-4803) | RBMS3 antibody (70R-4803) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors