RD3 antibody (70R-3852)

Rabbit polyclonal RD3 antibody raised against the N terminal of RD3

Synonyms Polyclonal RD3 antibody, Anti-RD3 antibody, RD 3, LCA12 antibody, Retinal Degeneration 3 antibody, RD-3, C1orf36 antibody, RD-3 antibody, RD3, RD 3 antibody
Specificity RD3 antibody was raised against the N terminal of RD3
Cross Reactivity Human
Applications WB
Immunogen RD3 antibody was raised using the N terminal of RD3 corresponding to a region with amino acids GQMREAERQQRERSNAVRKVCTGVDYSWLASTPRSTYDLSPIERLQLEDV
Assay Information RD3 Blocking Peptide, catalog no. 33R-3503, is also available for use as a blocking control in assays to test for specificity of this RD3 antibody


Western Blot analysis using RD3 antibody (70R-3852)

RD3 antibody (70R-3852) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 23 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RD3 is preferentially expressed in retina.Defects in RD3 are the cause of Leber congenital amaurosis type 12 (LCA12).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RD3 antibody (70R-3852) | RD3 antibody (70R-3852) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors