RDBP antibody (70R-4683)

Rabbit polyclonal RDBP antibody raised against the N terminal of RDBP

Synonyms Polyclonal RDBP antibody, Anti-RDBP antibody, RDP antibody, RD antibody, Rd Rna Binding Protein antibody, NELF-E antibody, D6S45 antibody
Specificity RDBP antibody was raised against the N terminal of RDBP
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RDBP antibody was raised using the N terminal of RDBP corresponding to a region with amino acids LVIPPGLSEEEEALQKKFNKLKKKKKALLALKKQSSSSTTSQGGVKRSLS
Assay Information RDBP Blocking Peptide, catalog no. 33R-5514, is also available for use as a blocking control in assays to test for specificity of this RDBP antibody


Western Blot analysis using RDBP antibody (70R-4683)

RDBP antibody (70R-4683) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 43 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RDBP antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RDBP is part of a complex termed negative elongation factor (NELF) which represses RNA polymerase II transcript elongation. This protein bears similarity to nuclear RNA-binding proteins; however, it has not been demonstrated that this protein binds RNA. The protein contains a tract of alternating basic and acidic residues, largely arginine (R) and aspartic acid (D).

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RDBP antibody (70R-4683) | RDBP antibody (70R-4683) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors