RDH16 antibody (70R-5493)

Rabbit polyclonal RDH16 antibody

Synonyms Polyclonal RDH16 antibody, Anti-RDH16 antibody, RDH 16, All-Trans antibody, RODH-4 antibody, RDH16, RDH 16 antibody, Retinol Dehydrogenase 16 antibody, RDH-16 antibody, RDH-16
Cross Reactivity Human
Applications WB
Immunogen RDH16 antibody was raised using a synthetic peptide corresponding to a region with amino acids SKERFLKSFLEIWDRSSPEVKEAYGEKFVADYKKSAEQMEQKCTQDLSLV
Assay Information RDH16 Blocking Peptide, catalog no. 33R-8550, is also available for use as a blocking control in assays to test for specificity of this RDH16 antibody


Western Blot analysis using RDH16 antibody (70R-5493)

RDH16 antibody (70R-5493) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RDH16 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RDH16 is an oxidoreductase with a preference for NAD. It oxidizes all-trans-retinol and 13-cis-retinol to the corresponding aldehydes. RDH16 has higher activity towards CRBP-bound retinol than with free retinol. It also oxidizes androstanediol and androsterone to dihydrotestosterone and androstanedione. RDH16 can also catalyze the reverse reaction.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RDH16 antibody (70R-5493) | RDH16 antibody (70R-5493) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors