REG1B antibody (70R-5333)

Rabbit polyclonal REG1B antibody raised against the N terminal of REG1B

Synonyms Polyclonal REG1B antibody, Anti-REG1B antibody, REGB 1, REGI-BETA antibody, REGB 1 antibody, REGL antibody, PSPS2 antibody, Regenerating Islet-Derived 1 Beta antibody, REGB-1 antibody, REGH antibody, REG1B, REGB-1
Specificity REG1B antibody was raised against the N terminal of REG1B
Cross Reactivity Human
Applications WB
Immunogen REG1B antibody was raised using the N terminal of REG1B corresponding to a region with amino acids MAQTNSFFMLISSLMFLSLSQGQESQTELPNPRISCPEGTNAYRSYCYYF
Assay Information REG1B Blocking Peptide, catalog no. 33R-5728, is also available for use as a blocking control in assays to test for specificity of this REG1B antibody

Images

Western Blot analysis using REG1B antibody (70R-5333)

REG1B antibody (70R-5333) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 16 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of REG1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance REG1B might act as an inhibitor of spontaneous calcium carbonate precipitation. REG1B may be associated with neuronal sprouting in brain, and with brain and pancreas regeneration.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using REG1B antibody (70R-5333) | REG1B antibody (70R-5333) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors