REM1 antibody (70R-4066)

Rabbit polyclonal REM1 antibody

Synonyms Polyclonal REM1 antibody, Anti-REM1 antibody, Ras antibody, REM-1 antibody, REM 1 antibody, REM antibody, GD:REM antibody, Rad And Gem-Like Gtp-Binding 1 antibody, GES antibody, MGC48669 antibody, REM-1, REM 1, REM1
Cross Reactivity Human
Applications WB
Immunogen REM1 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDSEGSWEALYRVVLLGDPGVGKTSLASLFAGKQERDLHEQLGEDVYERT
Assay Information REM1 Blocking Peptide, catalog no. 33R-8372, is also available for use as a blocking control in assays to test for specificity of this REM1 antibody


Western Blot analysis using REM1 antibody (70R-4066)

REM1 antibody (70R-4066) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 33 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of REM1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene is a GTPase and member of the RAS-like GTP-binding protein family. The encoded protein is expressed in endothelial cells, where it promotes reorganization of the actin cytoskeleton and morphological changes in the cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using REM1 antibody (70R-4066) | REM1 antibody (70R-4066) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors