Renin antibody (70R-1584)

Rabbit polyclonal Renin antibody raised against the C terminal of REN

Synonyms Polyclonal Renin antibody, Anti-Renin antibody, REN antibody, FLJ10761 antibody
Specificity Renin antibody was raised against the C terminal of REN
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen Renin antibody was raised using the C terminal of REN corresponding to a region with amino acids YSSKKLCTLAIHAMDIPPPTGPTWALGATFIRKFYTEFDRRNNRIGFALA
Assay Information Renin Blocking Peptide, catalog no. 33R-10250, is also available for use as a blocking control in assays to test for specificity of this Renin antibody

Images

Western Blot analysis using Renin antibody (70R-1584)

Renin antibody (70R-1584) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 45 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of REN antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Renin catalyzes the first step in the activation pathway of angiotensinogen--a cascade that can result in aldosterone release,vasoconstriction, and increase in blood pressure. Renin, an aspartyl protease, cleaves angiotensinogen to form angiotensin I, which is converted to angiotensin II by angiotensin I converting enzyme, an important regulator of blood pressure and electrolyte balance. Mutations in this gene have been shown to cause familial hyperproreninemia.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using Renin antibody (70R-1584) | Renin antibody (70R-1584) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £252.39
Size: 100 ug
OR
Shipping
View Our Distributors