RFC3 antibody (70R-5507)

Rabbit polyclonal RFC3 antibody

Synonyms Polyclonal RFC3 antibody, Anti-RFC3 antibody, RFC-3 antibody, RFC 3 antibody, RFC-3, RFC38 antibody, Replication Factor C3 antibody, RFC 3, MGC5276 antibody, RFC3
Cross Reactivity Human,Dog
Applications WB
Immunogen RFC3 antibody was raised using a synthetic peptide corresponding to a region with amino acids YHLEVNPSDAGNSDRVVIQEMLKTVAQSQQLETNSQRDFKVVLLTEVDKL
Assay Information RFC3 Blocking Peptide, catalog no. 33R-10126, is also available for use as a blocking control in assays to test for specificity of this RFC3 antibody

Images

Western Blot analysis using RFC3 antibody (70R-5507)

RFC3 antibody (70R-5507) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 40 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RFC3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC3 is the 38 kDa subunit. This subunit is essential for the interaction between the 140 kDa subunit and the core complex that consists of the 36, 37, and 40 kDa subunits.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RFC3 antibody (70R-5507) | RFC3 antibody (70R-5507) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors