RFC5 antibody (70R-5530)

Rabbit polyclonal RFC5 antibody

Synonyms Polyclonal RFC5 antibody, Anti-RFC5 antibody, RFC5, Replication Factor C5 antibody, RFC36 antibody, RFC-5, RFC-5 antibody, RFC 5, MGC1155 antibody, RFC 5 antibody
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen RFC5 antibody was raised using a synthetic peptide corresponding to a region with amino acids METSALKQQEQPAATKIRNLPWVEKYRPQTLNDLISHQDILSTIQKFINE
Assay Information RFC5 Blocking Peptide, catalog no. 33R-5977, is also available for use as a blocking control in assays to test for specificity of this RFC5 antibody


Immunohistochemical staining using RFC5 antibody (70R-5530)

RFC5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RFC5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The elongation of primed DNA templates by DNA polymerase delta and DNA polymerase epsilon requires the accessory proteins proliferating cell nuclear antigen (PCNA) and replication factor C (RFC). RFC, also named activator 1, is a protein complex consisting of five distinct subunits of 140, 40, 38, 37, and 36 kDa. RFC5 is the 36 kDa subunit. This subunit can interact with the C-terminal region of PCNA. It forms a core complex with the 38 and 40 kDa subunits. The core complex possesses DNA-dependent ATPase activity, which was found to be stimulated by PCNA in an in vitro system.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using RFC5 antibody (70R-5530) | RFC5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using RFC5 antibody (70R-5530) | RFC5 antibody (70R-5530) used at 1 ug/ml to detect target protein.
  • Immunohistochemical staining using RFC5 antibody (70R-5530) | RFC5 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors