RFESD antibody (70R-4404)

Rabbit polyclonal RFESD antibody

Synonyms Polyclonal RFESD antibody, Anti-RFESD antibody, Rieske antibody, Fe-S Domain Containing antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen RFESD antibody was raised using a synthetic peptide corresponding to a region with amino acids VVHDREVVIFYHKGEYHAMDIRCYHSGGPLHLGDIEDFDGRPCIVCPWHK
Assay Information RFESD Blocking Peptide, catalog no. 33R-9881, is also available for use as a blocking control in assays to test for specificity of this RFESD antibody


Western Blot analysis using RFESD antibody (70R-4404)

RFESD antibody (70R-4404) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 18 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RFESD antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RFESD protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RFESD antibody (70R-4404) | RFESD antibody (70R-4404) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors