RFTN2 antibody (70R-4543)

Rabbit polyclonal RFTN2 antibody raised against the N terminal of RFTN2

Synonyms Polyclonal RFTN2 antibody, Anti-RFTN2 antibody, RFTN 2 antibody, FLJ30574 antibody, RFTN2, C2orf11 antibody, RFTN-2 antibody, Raftlin Family Member 2 antibody, RFTN 2, Raftlin-2 antibody, RFTN-2, MGC117313 antibody
Specificity RFTN2 antibody was raised against the N terminal of RFTN2
Cross Reactivity Human
Applications WB
Immunogen RFTN2 antibody was raised using the N terminal of RFTN2 corresponding to a region with amino acids MGCGLRKLEDPDDSSPGKIFSTLKRPQVETKTEFAYEYVLLDFTLQASSN
Assay Information RFTN2 Blocking Peptide, catalog no. 33R-6014, is also available for use as a blocking control in assays to test for specificity of this RFTN2 antibody

Images

Western Blot analysis using RFTN2 antibody (70R-4543)

RFTN2 antibody (70R-4543) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RFTN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of the protein has not been widely studied, and is yet to be fully elucidated.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RFTN2 antibody (70R-4543) | RFTN2 antibody (70R-4543) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors