RG9MTD1 antibody (70R-4806)

Rabbit polyclonal RG9MTD1 antibody

Synonyms Polyclonal RG9MTD1 antibody, Anti-RG9MTD1 antibody, FLJ20432 antibody, RNA guanine 9 methyltransferase domain containing 1 antibody, RG9MTD1, RGMTD1 9, RGMTD1 9 antibody, RGMTD1-9, RGMTD1-9 antibody
Cross Reactivity Human
Applications WB
Immunogen RG9MTD1 antibody was raised using a synthetic peptide corresponding to a region with amino acids KKARQIKKEMKAAAREEAKNIKLLETTEEDKQKNFLFLRLWDRNMDIAMG
Assay Information RG9MTD1 Blocking Peptide, catalog no. 33R-4449, is also available for use as a blocking control in assays to test for specificity of this RG9MTD1 antibody


Western Blot analysis using RG9MTD1 antibody (70R-4806)

RG9MTD1 antibody (70R-4806) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 47 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RG9MTD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RG9MTD1 functions in mitochondrial tRNA maturation. Part of mitochondrial ribonuclease P, an enzyme composed of MRPP1/RG9MTD1, MRPP2/HSD17B10 and MRPP3/KIAA0391, which cleaves tRNA molecules in their 5'-ends.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RG9MTD1 antibody (70R-4806) | RG9MTD1 antibody (70R-4806) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors