RG9MTD2 antibody (70R-1472)

Rabbit polyclonal RG9MTD2 antibody

Synonyms Polyclonal RG9MTD2 antibody, Anti-RG9MTD2 antibody, RGMTD2-9, RNA guanine 9 methyltransferase domain containing 2 antibody, RG9MTD2, RGMTD2 9 antibody, RGMTD2-9 antibody, RGMTD2 9
Cross Reactivity Human
Applications WB
Immunogen RG9MTD2 antibody was raised using a synthetic peptide corresponding to a region with amino acids EDLIYLTSDSPNILKELDESKAYVIGGLVDHNHHKGLTYKQASDYGINHA
Assay Information RG9MTD2 Blocking Peptide, catalog no. 33R-2317, is also available for use as a blocking control in assays to test for specificity of this RG9MTD2 antibody

Images

Western Blot analysis using RG9MTD2 antibody (70R-1472)

RG9MTD2 antibody (70R-1472) used at 2.5 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 37 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RG9MTD2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RG9MTD2 is a probable RNA methyltransferase.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RG9MTD2 antibody (70R-1472) | RG9MTD2 antibody (70R-1472) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors