RG9MTD3 antibody (70R-4975)

Rabbit polyclonal RG9MTD3 antibody

Synonyms Polyclonal RG9MTD3 antibody, Anti-RG9MTD3 antibody, bA3J10.9 antibody, RP11-3J10.9 antibody, RGMTD3 9, RGMTD3-9, RG9MTD3, RNA guanine 9 methyltransferase domain containing 3 antibody, RGMTD3 9 antibody, FLJ31455 antibody, RGMTD3-9 antibody
Cross Reactivity Human,Mouse
Applications WB
Immunogen RG9MTD3 antibody was raised using a synthetic peptide corresponding to a region with amino acids HALEDVDLNKVYILGGLVDESIQKKVTFQKAREYSVKTARLPIQEYMVRN
Assay Information RG9MTD3 Blocking Peptide, catalog no. 33R-3692, is also available for use as a blocking control in assays to test for specificity of this RG9MTD3 antibody


Western Blot analysis using RG9MTD3 antibody (70R-4975)

RG9MTD3 antibody (70R-4975) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 36 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RG9MTD3 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RG9MTD3 belongs to the RNA methyltransferase trmD family, TRM10 subfamily. It is a probable RNA methyltransferase.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RG9MTD3 antibody (70R-4975) | RG9MTD3 antibody (70R-4975) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors