RGS10 antibody (70R-1242)

Rabbit polyclonal RGS10 antibody raised against the middle region of RGS10

Synonyms Polyclonal RGS10 antibody, Anti-RGS10 antibody, RGS-10 antibody, RGS 10 antibody, RGS10, RGS-10, RGS 10, Regulator Of G-Protein Signalling 10 antibody
Specificity RGS10 antibody was raised against the middle region of RGS10
Cross Reactivity Human
Applications WB
Immunogen RGS10 antibody was raised using the middle region of RGS10 corresponding to a region with amino acids DQIFNLMKYDSYSRFLKSDLFLKHKRTEEEEEDLPDAQTAAKRASRIYNT
Assay Information RGS10 Blocking Peptide, catalog no. 33R-2132, is also available for use as a blocking control in assays to test for specificity of this RGS10 antibody


Western blot analysis using RGS10 antibody (70R-1242)

Recommended RGS10 Antibody


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RGS10 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Regulator of G protein signaling (RGS) family members are regulatory molecules that act as GTPase activating proteins (GAPs) for G alpha subunits of heterotrimeric G proteins. RGS proteins are able to deactivate G protein subunits of the Gi alpha, Go alpha and Gq alpha subtypes. They drive G proteins into their inactive GDP-bound forms. Regulator of G protein signaling 10 belongs to this family. All RGS proteins share a conserved 120-amino acid sequence termed the RGS domain.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using RGS10 antibody (70R-1242) | Recommended RGS10 Antibody

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors