RGS13 antibody (70R-1144)

Rabbit polyclonal RGS13 antibody raised against the middle region of RGS13

Synonyms Polyclonal RGS13 antibody, Anti-RGS13 antibody, RGS-13, Regulator Of G-Protein Signalling 13 antibody, RGS 13, RGS-13 antibody, RGS 13 antibody, RGS13
Specificity RGS13 antibody was raised against the middle region of RGS13
Cross Reactivity Human,Dog
Applications IHC, WB
Immunogen RGS13 antibody was raised using the middle region of RGS13 corresponding to a region with amino acids WSRISRAKKLYKIYIQPQSPREINIDSSTRETIIRNIQEPTETCFEEAQK
Assay Information RGS13 Blocking Peptide, catalog no. 33R-10015, is also available for use as a blocking control in assays to test for specificity of this RGS13 antibody

Images

Western Blot analysis using RGS13 antibody (70R-1144)

RGS13 antibody (70R-1144) used at 1.25 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RGS13 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RGS13 encodes a protein which is a member of the regulator of G protein signaling (RGS) family. RGS proteins accelerate GTPase activity of G protein alpha-subunits, thereby driving G protein into their inactive GDP-bound form, thus negatively regulating G protein signaling. RGS proteins have been implicated in the fine tuning of a variety of cellular events in response to G protein-coupled receptor activation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RGS13 antibody (70R-1144) | RGS13 antibody (70R-1144) used at 1.25 ug/ml to detect target protein.

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors