RGS20 antibody (70R-1143)

Rabbit polyclonal RGS20 antibody raised against the middle region of RGS20

Synonyms Polyclonal RGS20 antibody, Anti-RGS20 antibody, RGS 20 antibody, RGS-20 antibody, RGS20, RGS-20, RGS 20, Regulator Of G-Protein Signalling 20 antibody
Specificity RGS20 antibody was raised against the middle region of RGS20
Cross Reactivity Human
Applications IHC, WB
Immunogen RGS20 antibody was raised using the middle region of RGS20 corresponding to a region with amino acids NAFREFLRTEFSEENMLFWMACEELKKEANKNIIEEKARIIYEDYISILS
Assay Information RGS20 Blocking Peptide, catalog no. 33R-6636, is also available for use as a blocking control in assays to test for specificity of this RGS20 antibody


Immunohistochemical staining using RGS20 antibody (70R-1143)

RGS20 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 27 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RGS20 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Regulator of G protein signaling (RGS) proteins are regulatory and structural components of G protein-coupled receptor complexes. RGS proteins are GTPase-activating proteins for Gi class G-alpha proteins. They accelerate transit through the cycle of GTP binding and hydrolysis and thereby accelerate signaling kinetics and termination.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using RGS20 antibody (70R-1143) | RGS20 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X
  • Western Blot analysis using RGS20 antibody (70R-1143) | RGS20 antibody (70R-1143) used at 2.5 ug/ml to detect target protein.

Availability: In stock

Price: £199.84
Size: 100 ug
View Our Distributors