RGS5 antibody (70R-3700)

Rabbit polyclonal RGS5 antibody raised against the middle region of RGS5

Synonyms Polyclonal RGS5 antibody, Anti-RGS5 antibody, RGS 5, RGS 5 antibody, MSTP106 antibody, MSTP129 antibody, MST129 antibody, MSTP092 antibody, RGS-5, MSTP032 antibody, Regulator Of G-Protein Signaling 5 antibody, MST106 antibody, RGS5, MST092 antibody, RGS-5 antibody
Specificity RGS5 antibody was raised against the middle region of RGS5
Cross Reactivity Human
Applications WB
Immunogen RGS5 antibody was raised using the middle region of RGS5 corresponding to a region with amino acids PGLAKPQHVTETFHPDPNWKNFQKPGTWRGSLDESSLGFGYPKFISHQDI
Assay Information RGS5 Blocking Peptide, catalog no. 33R-7114, is also available for use as a blocking control in assays to test for specificity of this RGS5 antibody

Images

Western Blot analysis using RGS5 antibody (70R-3700)

RGS5 antibody (70R-3700) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 21 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RGS5 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The regulator of G protein signaling (RGS) proteins are signal transduction molecules that have structural homology to SST2 of Saccharomyces cerevisiae and EGL-10 of Caenorhabditis elegans. Multiple genes homologous to SST2 are present in higher eukaryotes. RGS proteins are involved in the regulation of heterotrimeric G proteins by acting as GTPase activators.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RGS5 antibody (70R-3700) | RGS5 antibody (70R-3700) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors