RIC8B antibody (70R-4367)

Rabbit polyclonal RIC8B antibody

Synonyms Polyclonal RIC8B antibody, Anti-RIC8B antibody, RIC8 antibody, RICB 8, MGC39476 antibody, FLJ10620 antibody, RICB-8 antibody, RICB 8 antibody, Resistance To Inhibitors Of Cholinesterase 8 Homolog B antibody, RICB-8, RIC8B, hSyn antibody
Cross Reactivity Human, Mouse, Rat
Applications WB
Immunogen RIC8B antibody was raised using a synthetic peptide corresponding to a region with amino acids KETVLKNNTMVYNGMNMEAIHVLLNFMEKRIDKGSSYREGLTPVLSLLTE
Assay Information RIC8B Blocking Peptide, catalog no. 33R-4361, is also available for use as a blocking control in assays to test for specificity of this RIC8B antibody


Western Blot analysis using RIC8B antibody (70R-4367)

RIC8B antibody (70R-4367) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 59 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RIC8B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RIC8B is a guanine nucleotide exchange factor (GEF), which can activate some, but not all, G-alpha proteins by exchanging bound GDP for free GTP (By similarity). Able to potentiate G(olf)-alpha-dependent cAMP accumulation suggesting that it may be an important component for odorant signal transduction.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RIC8B antibody (70R-4367) | RIC8B antibody (70R-4367) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors