RIOK2 antibody (70R-3723)

Rabbit polyclonal RIOK2 antibody

Synonyms Polyclonal RIOK2 antibody, Anti-RIOK2 antibody, RIOK 2, RIOK-2 antibody, RIOK 2 antibody, Rio Kinase 2 antibody, RIOK-2, RIOK2, FLJ11159 antibody
Cross Reactivity Human
Applications WB
Immunogen RIOK2 antibody was raised using a synthetic peptide corresponding to a region with amino acids SDIYIVANEEGQQFALKLHRLGRTSFRNLKNKRDYHKHRHNVSWLYLSRL
Assay Information RIOK2 Blocking Peptide, catalog no. 33R-8357, is also available for use as a blocking control in assays to test for specificity of this RIOK2 antibody

Images

Western Blot analysis using RIOK2 antibody (70R-3723)

RIOK2 antibody (70R-3723) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RIOK2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RIOK2 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RIOK2 antibody (70R-3723) | RIOK2 antibody (70R-3723) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors