RNF175 antibody (70R-1170)

Rabbit polyclonal RNF175 antibody raised against the middle region of RNF175

Synonyms Polyclonal RNF175 antibody, Anti-RNF175 antibody, RNF-175, FLJ34190 antibody, RNF 175 antibody, RNF-175 antibody, RNF175, Ring Finger Protein 175 antibody, RNF 175
Specificity RNF175 antibody was raised against the middle region of RNF175
Cross Reactivity Human
Applications WB
Immunogen RNF175 antibody was raised using the middle region of RNF175 corresponding to a region with amino acids YGLYYGVMGRDFAEICSDYMASTIGFYSVSRLPTRSLSDNICAVCGQKII
Assay Information RNF175 Blocking Peptide, catalog no. 33R-10107, is also available for use as a blocking control in assays to test for specificity of this RNF175 antibody

Specifications

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 19 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RNF175 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNF175 is involved in protein binding, zinc ion binding and metal ion binding

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Availability: In stock

Price: £220.34
Size: 100 ug
OR
Shipping
View Our Distributors