RNF44 antibody (70R-2251)

Rabbit polyclonal RNF44 antibody raised against the N terminal of RNF44

Synonyms Polyclonal RNF44 antibody, Anti-RNF44 antibody, Ring Finger Protein 44 antibody, RNF44, RNF 44, RNF 44 antibody, RNF-44, KIAA1100 antibody, RNF-44 antibody
Specificity RNF44 antibody was raised against the N terminal of RNF44
Cross Reactivity Human
Applications WB
Immunogen RNF44 antibody was raised using the N terminal of RNF44 corresponding to a region with amino acids LSYTVTTVTTQGFPLPTGQHIPGCSAQQLPACSVMFSGQHYPLCCLPPPL
Assay Information RNF44 Blocking Peptide, catalog no. 33R-5467, is also available for use as a blocking control in assays to test for specificity of this RNF44 antibody


Western Blot analysis using RNF44 antibody (70R-2251)

RNF44 antibody (70R-2251) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 48 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RNF44 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by this gene contains a RING finger, a motif present in a variety of functionally distinct proteins and known to be involved in protein-protein and protein-DNA interactions.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RNF44 antibody (70R-2251) | RNF44 antibody (70R-2251) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors