RORA antibody (70R-1006)

Rabbit polyclonal RORA antibody raised against the middle region of RORA

Synonyms Polyclonal RORA antibody, Anti-RORA antibody, ROR2 antibody, RZRA antibody, MGC119329 antibody, ROR3 antibody, ROR1 antibody, NR1F1 antibody, Rar-Related Orphan Receptor A antibody, MGC119326 antibody
Specificity RORA antibody was raised against the middle region of RORA
Cross Reactivity Human, Mouse, Rat, Dog, ZebraFish
Applications IHC, WB
Immunogen RORA antibody was raised using the middle region of RORA corresponding to a region with amino acids GHTPEGSKADSAVSSFYLDIQPSPDQSGLDINGIKPEPICDYTPASGFFP
Assay Information RORA Blocking Peptide, catalog no. 33R-3316, is also available for use as a blocking control in assays to test for specificity of this RORA antibody

Western blot analysis using RORA antibody (70R-1006)

Recommended RORA Antibody Titration: 1.25ug/ml

Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RORA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.

Add a Paper

Sorry, but there are no references currently for this product.

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

  • Western blot analysis using RORA antibody (70R-1006) | Recommended RORA Antibody Titration: 1.25ug/ml
  • Immunohistochemical staining using RORA antibody (70R-1006) | Human Kidney
  • Western blot analysis using RORA antibody (70R-1006) | Tissue analyzed: Jurkat Lane A: Primary Antibody Lane B: Primary Antibody + Blocking Peptide. Primary Antibody Concentration:2.5ug/mL Peptide Concentration: 2.0ug/mL Lysate Quantity: 25ug/lane Gel Concentration: 12%

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors