RORA antibody (70R-1921)

Rabbit polyclonal RORA antibody raised against the N terminal of RORA

Synonyms Polyclonal RORA antibody, Anti-RORA antibody, RZRA antibody, Rar-Related Orphan Receptor A antibody, ROR3 antibody, MGC119326 antibody, ROR2 antibody, NR1F1 antibody, MGC119329 antibody, ROR1 antibody
Specificity RORA antibody was raised against the N terminal of RORA
Cross Reactivity Human
Applications WB
Immunogen RORA antibody was raised using the N terminal of RORA corresponding to a region with amino acids TPTPAGEGARRDELFGILQILHQCILSSGDAFVLTGVCCSWRQNGKPPYS
Assay Information RORA Blocking Peptide, catalog no. 33R-9233, is also available for use as a blocking control in assays to test for specificity of this RORA antibody


Western blot analysis using RORA antibody (70R-1921)

Recommended RORA Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 63 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RORA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The protein encoded by RORA is a member of the NR1 subfamily of nuclear hormone receptors. It can bind as a monomer or as a homodimer to hormone response elements upstream of several genes to enhance the expression of those genes. The specific functions of this protein are not known, but it has been shown to interact with NM23-2, a nucleoside diphosphate kinase involved in organogenesis and differentiation, as well as with NM23-1, the product of a tumor metastasis suppressor candidate gene.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using RORA antibody (70R-1921) | Recommended RORA Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £276.43
Size: 50 ug
View Our Distributors