RORC antibody (70R-2142)

Rabbit polyclonal RORC antibody raised against the N terminal of RORC

Synonyms Polyclonal RORC antibody, Anti-RORC antibody, Rar-Related Orphan Receptor C antibody, TOR antibody, RORG antibody, RZRG antibody, NR1F3 antibody, MGC129539 antibody
Specificity RORC antibody was raised against the N terminal of RORC
Cross Reactivity Human
Applications WB
Immunogen RORC antibody was raised using the N terminal of RORC corresponding to a region with amino acids EPVVKTPPAGAQGADTLTYTLGLPDGQLPLGSSPDLPEASACPPGLLKAS
Assay Information RORC Blocking Peptide, catalog no. 33R-2655, is also available for use as a blocking control in assays to test for specificity of this RORC antibody

Images

Western blot analysis using RORC antibody (70R-2142)

Recommended RORC Antibody Titration: 1 ug/ml

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 56 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RORC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RORC encodes a protein which is a DNA-binding transcription factor and is a member of the NR1 subfamily of nuclear hormone receptors. The specific functions of this protein are not known; however, studies of a similar gene in mice have shown that RORC may be essential for lymphoid organogenesis and may play an important regulatory role in thymopoiesis. In addition, studies in mice suggest that the protein encoded by this gene may inhibit the expression of Fas ligand and IL2.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western blot analysis using RORC antibody (70R-2142) | Recommended RORC Antibody Titration: 1 ug/ml

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors