RPL18 antibody (70R-5007)

Rabbit polyclonal RPL18 antibody raised against the N terminal of RPL18

Synonyms Polyclonal RPL18 antibody, Anti-RPL18 antibody, Ribosomal Protein L18 antibody, RPL-18, RPL 18, RPL-18 antibody, RPL 18 antibody, RPL18
Specificity RPL18 antibody was raised against the N terminal of RPL18
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RPL18 antibody was raised using the N terminal of RPL18 corresponding to a region with amino acids MGVDIRHNKDRKVRRKEPKSQDIYLRLLVKLYRFLARRTNSTFNQVVLKR
Assay Information RPL18 Blocking Peptide, catalog no. 33R-6085, is also available for use as a blocking control in assays to test for specificity of this RPL18 antibody


Western Blot analysis using RPL18 antibody (70R-5007)

RPL18 antibody (70R-5007) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 22 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPL18 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. This gene encodes a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L18E family of ribosomal proteins. It is located in the cytoplasm. As is typical for genes encoding ribosomal proteins, there are multiple processed pseudogenes of this gene dispersed through the genome.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPL18 antibody (70R-5007) | RPL18 antibody (70R-5007) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors