RPL30 antibody (70R-1998)

Rabbit polyclonal RPL30 antibody raised against the middle region of RPL30

Synonyms Polyclonal RPL30 antibody, Anti-RPL30 antibody, RPL30, RPL 30 antibody, RPL-30 antibody, Ribosomal Protein L30 antibody, RPL 30, RPL-30
Specificity RPL30 antibody was raised against the middle region of RPL30
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RPL30 antibody was raised using the middle region of RPL30 corresponding to a region with amino acids LKMIRQGKAKLVILANNCPALRKSEIEYYAMLAKTGVHHYSGNNIELGTA
Assay Information RPL30 Blocking Peptide, catalog no. 33R-5092, is also available for use as a blocking control in assays to test for specificity of this RPL30 antibody

Images

Western Blot analysis using RPL30 antibody (70R-1998)

RPL30 antibody (70R-1998) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 13 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPL30 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Ribosomes, the organelles that catalyze protein synthesis, consist of a small 40S subunit and a large 60S subunit. Together these subunits are composed of 4 RNA species and approximately 80 structurally distinct proteins. RPL30 is a ribosomal protein that is a component of the 60S subunit. The protein belongs to the L30E family of ribosomal proteins. It is located in the cytoplasm. This gene encoding RPL30 is co-transcribed with the U72 small nucleolar RNA gene, which is located in its fourth intron.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RPL30 antibody (70R-1998) | RPL30 antibody (70R-1998) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors