RPS27L antibody (70R-4341)

Rabbit polyclonal RPS27L antibody raised against the N terminal of RPS27L

Synonyms Polyclonal RPS27L antibody, Anti-RPS27L antibody, RPS 27, RPS-27, RPS 27 antibody, RPS-27 antibody, RPS27, Ribosomal Protein S27-Like antibody
Specificity RPS27L antibody was raised against the N terminal of RPS27L
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RPS27L antibody was raised using the N terminal of RPS27L corresponding to a region with amino acids MPLARDLLHPSLEEEKKKHKKKRLVQSPNSYFMDVKCPGCYKITTVFSHA
Assay Information RPS27L Blocking Peptide, catalog no. 33R-6290, is also available for use as a blocking control in assays to test for specificity of this RPS27L antibody


Western Blot analysis using RPS27L antibody (70R-4341)

RPS27L antibody (70R-4341) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 9 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RPS27L antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes a protein sharing 96% amino acid similarity with ribosomal protein S27, which suggests the encoded protein may be a component of the 40S ribosomal subunit.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RPS27L antibody (70R-4341) | RPS27L antibody (70R-4341) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors