RRAGC antibody (70R-3630)

Rabbit polyclonal RRAGC antibody raised against the N terminal of RRAGC

Synonyms Polyclonal RRAGC antibody, Anti-RRAGC antibody, GTR2 antibody, FLJ13311 antibody, Ras-Related Gtp Binding C antibody, RAGC antibody
Specificity RRAGC antibody was raised against the N terminal of RRAGC
Cross Reactivity Human
Applications WB
Immunogen RRAGC antibody was raised using the N terminal of RRAGC corresponding to a region with amino acids RSGKSSIQKVVFHKMSPNETLFLESTNKIYKDDISNSSFVNFQIWDFPGQ
Assay Information RRAGC Blocking Peptide, catalog no. 33R-8180, is also available for use as a blocking control in assays to test for specificity of this RRAGC antibody

Images

Western Blot analysis using RRAGC antibody (70R-3630)

RRAGC antibody (70R-3630) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 44 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RRAGC antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RRAGC is a monomeric guanine nucleotide-binding protein, or G protein. By binding GTP or GDP, small G proteins act as molecular switches in numerous cell processes and signaling pathways.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RRAGC antibody (70R-3630) | RRAGC antibody (70R-3630) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors