RSU1 antibody (70R-1142)

Rabbit polyclonal RSU1 antibody raised against the C terminal of RSU1

Synonyms Polyclonal RSU1 antibody, Anti-RSU1 antibody, RSU 1 antibody, RSU1, FLJ31034 antibody, RSU 1, RSU-1 antibody, RSP-1 antibody, Ras Suppressor Protein 1 antibody, RSU-1
Specificity RSU1 antibody was raised against the C terminal of RSU1
Cross Reactivity Human, Mouse, Rat
Applications IHC, WB
Immunogen RSU1 antibody was raised using the C terminal of RSU1 corresponding to a region with amino acids PIADQFQLGVSHVFEYIRSETYKYLYGRHMQANPEPPKKNNDKSKKISRK
Assay Information RSU1 Blocking Peptide, catalog no. 33R-7149, is also available for use as a blocking control in assays to test for specificity of this RSU1 antibody


Immunohistochemical staining using RSU1 antibody (70R-1142)

RSU1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 31 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RSU1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1.25 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RSU1 is a protein that is involved in the Ras signal transduction pathway, growth inhibition, and nerve-growth factor induced differentiation processes, as determined in mouse and human cell line studies. In mouse, the protein was initially isolated based on its ability to inhibit v-Ras transformation.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using RSU1 antibody (70R-1142) | RSU1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using RSU1 antibody (70R-1142) | RSU1 antibody (70R-1142) used at 1.25 ug/ml to detect target protein.
  • Immunohistochemical staining using RSU1 antibody (70R-1142) | RSU1 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Epithelial cells of renal tubule (arrows) in Human Kidney. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors