RTCD1 antibody (70R-4721)

Rabbit polyclonal RTCD1 antibody raised against the N terminal of RTCD1

Synonyms Polyclonal RTCD1 antibody, Anti-RTCD1 antibody, RTCD-1 antibody, RTCD1, RNA Terminal Phosphate Cyclase Domain 1 antibody, RTCD-1, RPC antibody, RTCD 1 antibody, RTCD 1
Specificity RTCD1 antibody was raised against the N terminal of RTCD1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RTCD1 antibody was raised using the N terminal of RTCD1 corresponding to a region with amino acids VQKIRAGRSTPGLRPQHLSGLEMIRDLCDGQLEGAEIGSTEITFTPEKIK
Assay Information RTCD1 Blocking Peptide, catalog no. 33R-9747, is also available for use as a blocking control in assays to test for specificity of this RTCD1 antibody

Images

Western Blot analysis using RTCD1 antibody (70R-4721)

RTCD1 antibody (70R-4721) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 39 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RTCD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RNA 3-prime-terminal phosphate cyclase catalyzes the ATP-dependent conversion of a 3-prime phosphate to a 2-prime,3-prime-cyclic phosphodiester at the end of RNA.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RTCD1 antibody (70R-4721) | RTCD1 antibody (70R-4721) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors