RTDR1 antibody (70R-3433)

Rabbit polyclonal RTDR1 antibody raised against the N terminal of RTDR1

Synonyms Polyclonal RTDR1 antibody, Anti-RTDR1 antibody, RTDR-1, RTDR 1 antibody, MGC16968 antibody, RTDR1, RTDR-1 antibody, Rhabdoid Tumor Deletion Region Gene 1 antibody, RTDR 1
Specificity RTDR1 antibody was raised against the N terminal of RTDR1
Cross Reactivity Human
Applications WB
Immunogen RTDR1 antibody was raised using the N terminal of RTDR1 corresponding to a region with amino acids MAHSQNSLELPININATQITTAYGHRALPKLKEELQSEDLQTRQKALMAL
Assay Information RTDR1 Blocking Peptide, catalog no. 33R-5675, is also available for use as a blocking control in assays to test for specificity of this RTDR1 antibody

Images

Western Blot analysis using RTDR1 antibody (70R-3433)

RTDR1 antibody (70R-3433) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 38 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RTDR1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RTDR1 protein is not widely studied, and is yet to be elucidated fully.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RTDR1 antibody (70R-3433) | RTDR1 antibody (70R-3433) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors