RTN2 antibody (70R-1758)

Rabbit polyclonal RTN2 antibody raised against the N terminal of RTN2

Synonyms Polyclonal RTN2 antibody, Anti-RTN2 antibody, RTN-2, NSP2 antibody, RTN2, RTN-2 antibody, RTN 2 antibody, RTN 2, Reticulon 2 antibody, NSPL1 antibody
Specificity RTN2 antibody was raised against the N terminal of RTN2
Cross Reactivity Human,Mouse,Rat
Applications IHC, WB
Immunogen RTN2 antibody was raised using the N terminal of RTN2 corresponding to a region with amino acids MGQVLPVFAHCKEAPSTASSTPDSTEGGNDDSDFRELHTAREFSEEDEEE
Assay Information RTN2 Blocking Peptide, catalog no. 33R-6064, is also available for use as a blocking control in assays to test for specificity of this RTN2 antibody


Immunohistochemical staining using RTN2 antibody (70R-1758)

RTN2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X


Host Rabbit
Method of Purification Total IgG Protein A purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 100ul distilled water for a 1mg/ml concentration of RTN2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 2.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene belongs to the family of reticulon encoding genes. Reticulons are associated with the endoplasmic reticulum, and are involved in neuroendocrine secretion or in membrane trafficking in neuroendocrine cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Immunohistochemical staining using RTN2 antibody (70R-1758) | RTN2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml. Magnification is at 400X
  • Western Blot analysis using RTN2 antibody (70R-1758) | RTN2 antibody (70R-1758) used at 2.5 ug/ml to detect target protein.
  • Immunohistochemical staining using RTN2 antibody (70R-1758) | RTN2 antibody was used for immunohistochemistry at a concentration of 4-8 ug/ml to stain Hepatocytes (arrows) in Human Liver. Magnification is at 400X

Availability: In stock

Price: £220.34
Size: 100 ug
View Our Distributors