RTP4 antibody (70R-3383)

Rabbit polyclonal RTP4 antibody

Synonyms Polyclonal RTP4 antibody, Anti-RTP4 antibody, RTP 4, Receptor Transporter Protein 4 antibody, RTP 4 antibody, RTP-4 antibody, Chemosensory Transporter Protein 4 antibody, RTP4, RTP-4, IFRG28 antibody
Cross Reactivity Human
Applications WB
Immunogen RTP4 antibody was raised using a synthetic peptide corresponding to a region with amino acids SSDSTMRILSNLVQHILKKYYGNGTRKSPEMPVILEVSLEGSHDTANCEA
Assay Information RTP4 Blocking Peptide, catalog no. 33R-8793, is also available for use as a blocking control in assays to test for specificity of this RTP4 antibody


Western Blot analysis using RTP4 antibody (70R-3383)

RTP4 antibody (70R-3383) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 28 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RTP4 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The function of RTP4 protein is not widely studied, and is yet to be elucidated fully.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using RTP4 antibody (70R-3383) | RTP4 antibody (70R-3383) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors