RUVBL2 antibody (70R-3566)

Rabbit polyclonal RUVBL2 antibody

Synonyms Polyclonal RUVBL2 antibody, Anti-RUVBL2 antibody, Ruvb-Like 2 antibody, RUVBL2, RUVBL 2, RUVBL-2, RUVBL-2 antibody, RUVBL 2 antibody
Cross Reactivity Human, Mouse, Rat, Dog
Applications IHC, WB
Immunogen RUVBL2 antibody was raised using a synthetic peptide corresponding to a region with amino acids IDRPATGTGSKVGKLTLKTTEMETIYDLGTKMIESLTKDKVQAGDVITID
Assay Information RUVBL2 Blocking Peptide, catalog no. 33R-3928, is also available for use as a blocking control in assays to test for specificity of this RUVBL2 antibody


Western blot analysis using RUVBL2 antibody (70R-3566)

Recommended RUVBL2 Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RUVBL2 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 0.5 ug/ml; IHC: 4-8 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RUVBL2 encodes the second human homologue of the bacterial RuvB gene. Bacterial RuvB protein is a DNA helicase essential for homologous recombination and DNA double-strand break repair. Functional analysis showed that this gene product has both ATPase and DNA helicase activities.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using RUVBL2 antibody (70R-3566) | Recommended RUVBL2 Antibody Titration: 0.2-1 ug/ml
  • Immunohistochemical staining using RUVBL2 antibody (70R-3566) | Human Liver
  • Western blot analysis using RUVBL2 antibody (70R-3566) | Lane 1: 30ug K562 lysate; Antibody Dilution : 1:200

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors