RWDD1 antibody (70R-4346)

Rabbit polyclonal RWDD1 antibody raised against the middle region of RWDD1

Synonyms Polyclonal RWDD1 antibody, Anti-RWDD1 antibody, Rwd Domain Containing 1 antibody, RWDD-1, RWDD-1 antibody, RWDD 1, RWDD 1 antibody, PTD013 antibody, RWDD1, CGI-24 antibody
Specificity RWDD1 antibody was raised against the middle region of RWDD1
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RWDD1 antibody was raised using the middle region of RWDD1 corresponding to a region with amino acids KKRMKEEEQAGKNKLSGKQLFETDHNLDTSDIQFLEDAGNNVEVDESLFQ
Assay Information RWDD1 Blocking Peptide, catalog no. 33R-4491, is also available for use as a blocking control in assays to test for specificity of this RWDD1 antibody

Images

Western Blot analysis using RWDD1 antibody (70R-4346)

RWDD1 antibody (70R-4346) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 17 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RWDD1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance The RWDD1 protein protects DRG2 from proteolytic degradation.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RWDD1 antibody (70R-4346) | RWDD1 antibody (70R-4346) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors