RXRA antibody (70R-1923)

Rabbit polyclonal RXRA antibody raised against the C terminal of RXRA

Synonyms Polyclonal RXRA antibody, Anti-RXRA antibody, NR2B1 antibody, MGC102720 antibody, FLJ16733 antibody, FLJ16020 antibody, Retinoid X Receptor Alpha antibody
Specificity RXRA antibody was raised against the C terminal of RXRA
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen RXRA antibody was raised using the C terminal of RXRA corresponding to a region with amino acids MDKTELGCLRAIVLFNPDSKGLSNPAEVEALREKVYASLEAYCKHKYPEQ
Assay Information RXRA Blocking Peptide, catalog no. 33R-5845, is also available for use as a blocking control in assays to test for specificity of this RXRA antibody


Western blot analysis using RXRA antibody (70R-1923)

Recommended RXRA Antibody Titration: 0.2-1 ug/ml


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 51 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RXRA antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Retinoid X receptors (RXRs) and retinoic acid receptors (RARs), are nuclear receptors that mediate the biological effects of retinoids by their involvement in retinoic acid-mediated gene activation. These receptors exert their action by binding, as homodimers or heterodimers, to specific sequences in the promoters of target genes and regulating their transcription.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western blot analysis using RXRA antibody (70R-1923) | Recommended RXRA Antibody Titration: 0.2-1 ug/ml

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors