RXRB antibody (70R-1920)

Rabbit polyclonal RXRB antibody raised against the N terminal of RXRB

Synonyms Polyclonal RXRB antibody, Anti-RXRB antibody, MGC1831 antibody, DAUDI6 antibody, H-2RIIBP antibody, Retinoid X Receptor Beta antibody, RCoR-1 antibody, NR2B2 antibody
Specificity RXRB antibody was raised against the N terminal of RXRB
Cross Reactivity Human,Mouse,Rat,Dog
Applications WB
Immunogen RXRB antibody was raised using the N terminal of RXRB corresponding to a region with amino acids PGFSGPVSSPQINSTVSLPGGGSGPPEDVKPPVLGVRGLHCPPPPGGPGA
Assay Information RXRB Blocking Peptide, catalog no. 33R-7103, is also available for use as a blocking control in assays to test for specificity of this RXRB antibody

Images

Western Blot analysis using RXRB antibody (70R-1920)

RXRB antibody (70R-1920) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 57 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of RXRB antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance RXRB is a member of the retinoid X receptor (RXR) family of nuclear receptors which are involved in mediating the effects of retinoic acid (RA). This receptor forms homodimers with the retinoic acid, thyroid hormone, and vitamin D receptors, increasing both DNA binding and transcriptional function on their respective response elements.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using RXRB antibody (70R-1920) | RXRB antibody (70R-1920) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors