SAMSN1 antibody (70R-1961)

Rabbit polyclonal SAMSN1 antibody raised against the middle region of SAMSN1

Synonyms Polyclonal SAMSN1 antibody, Anti-SAMSN1 antibody, NASH1 antibody, HACS1 antibody, SAMSN 1 antibody, SAMSN-1 antibody, SAMSN-1, SAMSN1, SAMSN 1, Sam Domain Sh3 Domain and Nuclear Localization Signals 1 antibody
Specificity SAMSN1 antibody was raised against the middle region of SAMSN1
Cross Reactivity Human
Applications WB
Immunogen SAMSN1 antibody was raised using the middle region of SAMSN1 corresponding to a region with amino acids DISLNKSQLDDCPRDSGCYISSGNSDNGKEDLESENLSDMVHKIIITEPS
Assay Information SAMSN1 Blocking Peptide, catalog no. 33R-2007, is also available for use as a blocking control in assays to test for specificity of this SAMSN1 antibody

Images

Western Blot analysis using SAMSN1 antibody (70R-1961)

SAMSN1 antibody (70R-1961) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 42 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SAMSN1 antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SAMSN1 is a member of a novel protein family of putative adaptors and scaffold proteins containing SH3 and SAM (sterile alpha motif) domains.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SAMSN1 antibody (70R-1961) | SAMSN1 antibody (70R-1961) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £276.43
Size: 50 ug
OR
Shipping
View Our Distributors