SCN1B antibody (70R-5206)

Rabbit polyclonal SCN1B antibody raised against the middle region of SCN1B

Synonyms Polyclonal SCN1B antibody, Anti-SCN1B antibody, SCNB-1 antibody, SCNB 1 antibody, SCN1B, Sodium Channel Voltage-Gated Type I Beta antibody, SCNB 1, GEFSP1 antibody, SCNB-1
Specificity SCN1B antibody was raised against the middle region of SCN1B
Cross Reactivity Human,Dog
Applications WB
Immunogen SCN1B antibody was raised using the middle region of SCN1B corresponding to a region with amino acids NVTYNHSGDYECHVYRLLFFENYEHNTSVVKKIHIEVVDKANRDMASIVS
Assay Information SCN1B Blocking Peptide, catalog no. 33R-6928, is also available for use as a blocking control in assays to test for specificity of this SCN1B antibody


Western Blot analysis using SCN1B antibody (70R-5206)

SCN1B antibody (70R-5206) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 25 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCN1B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-gated sodium channels are essential for the generation and propagation of action potentials in striated muscle and neuronal tissues. Biochemically, they consist of a large alpha subunit and 1 or 2 smaller beta subunits, such as SCN1B. The alpha subunit alone can exhibit all the functional attributes of a voltage-gated Na+ channel, but requires a beta-1 subunit for normal inactivation kinetics.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SCN1B antibody (70R-5206) | SCN1B antibody (70R-5206) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors