SCN8A antibody (70R-5129)

Rabbit polyclonal SCN8A antibody raised against the middle region of SCN8A

Synonyms Polyclonal SCN8A antibody, Anti-SCN8A antibody, SCNA-8, MED antibody, SCN8A, Sodium Channel Voltage Gated Type Viii Alpha Subunit antibody, NaCh6 antibody, SCNA 8, SCNA-8 antibody, CerIII antibody, Nav1.6 antibody, PN4 antibody, SCNA 8 antibody
Specificity SCN8A antibody was raised against the middle region of SCN8A
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SCN8A antibody was raised using the middle region of SCN8A corresponding to a region with amino acids ESDPEGSKDKLDDTSSSEGSTIDIKPEVEEVPVEQPEEYLDPDACFTEGC
Assay Information SCN8A Blocking Peptide, catalog no. 33R-2720, is also available for use as a blocking control in assays to test for specificity of this SCN8A antibody


Western Blot analysis using SCN8A antibody (70R-5129)

SCN8A antibody (70R-5129) used at 1 ug/ml to detect target protein.


Host Rabbit
Method of Purification Affinity purified
Molecular Weight 225 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SCN8A antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance Voltage-dependent sodium channels, such as SCN8A, are responsible for the initial membrane depolarization that occurs during generation of action potentials in most electrically excitable cells.

Add a Paper

Sorry, but there are no references currently for this product.


You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product


  • Western Blot analysis using SCN8A antibody (70R-5129) | SCN8A antibody (70R-5129) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
View Our Distributors