SDR-O antibody (70R-4417)

Rabbit polyclonal SDR-O antibody raised against the middle region of SDR-O

Synonyms Polyclonal SDR-O antibody, Anti-SDR-O antibody, SDRO antibody, MGC126602 antibody, FLJ16333 antibody, Orphan Short-Chain Dehydrogenase / Reductase antibody, RDHS antibody, MGC126600 antibody
Specificity SDR-O antibody was raised against the middle region of SDR-O
Cross Reactivity Human,Mouse
Applications WB
Immunogen SDR-O antibody was raised using the middle region of SDR-O corresponding to a region with amino acids SMEHAIVSRSPRIRYNPGLDAKLLYIPLAKLPTPVTDFILSRYLPRPADS
Assay Information SDR-O Blocking Peptide, catalog no. 33R-10433, is also available for use as a blocking control in assays to test for specificity of this SDR-O antibody

Images

Western Blot analysis using SDR-O antibody (70R-4417)

SDR-O antibody (70R-4417) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 35 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SDR-O antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SDR-O displays weak conversion of all-trans-retinal to all-trans-retinol in the presence of NADH. Has apparently no steroid dehydrogenase activity.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SDR-O antibody (70R-4417) | SDR-O antibody (70R-4417) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors