SDS antibody (70R-3762)

Rabbit polyclonal SDS antibody raised against the middle region of SDS

Synonyms Polyclonal SDS antibody, Anti-SDS antibody, Serine Dehydratase antibody, SDH antibody
Specificity SDS antibody was raised against the middle region of SDS
Cross Reactivity Human
Applications WB
Immunogen SDS antibody was raised using the middle region of SDS corresponding to a region with amino acids KITSVAKALGVKTVGAQALKLFQEHPIFSEVISDQEAVAAIEKFVDDEKI
Assay Information SDS Blocking Peptide, catalog no. 33R-4446, is also available for use as a blocking control in assays to test for specificity of this SDS antibody

Images

Western Blot analysis using SDS antibody (70R-3762)

SDS antibody (70R-3762) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 34 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SDS antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance This gene encodes one of three enzymes that are involved in metabolizing serine and glycine. L-serine dehydratase converts L-serine to pyruvate and ammonia and requires pyridoxal phosphate as a cofactor.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SDS antibody (70R-3762) | SDS antibody (70R-3762) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors