SEC23B antibody (70R-3255)

Rabbit polyclonal SEC23B antibody

Synonyms Polyclonal SEC23B antibody, Anti-SEC23B antibody, Sec23 Homolog B antibody, SEC 23 antibody, SEC 23, SEC-23 antibody, SEC-23, SEC23
Cross Reactivity Human,Mouse,Rat
Applications WB
Immunogen SEC23B antibody was raised using a synthetic peptide corresponding to a region with amino acids SFSLYPQFMFHLRRSPFLQVFNNSPDESSYYRHHFARQDLTQSLIMIQPI
Assay Information SEC23B Blocking Peptide, catalog no. 33R-8439, is also available for use as a blocking control in assays to test for specificity of this SEC23B antibody

Images

Western Blot analysis using SEC23B antibody (70R-3255)

SEC23B antibody (70R-3255) used at 1 ug/ml to detect target protein.

Specifications

Host Rabbit
Method of Purification Affinity purified
Molecular Weight 86 kDa (MW of target protein)
Form & Buffer Lyophilized powder. Add 50ul distilled water for a 1mg/ml concentration of SEC23B antibody in PBS
Concentration 1 mg/ml

Usage & Assay Information

Usage Recommendations WB: 1 ug/ml

Storage & Safety

Storage Store at 2-8 deg C for short periods. For longer periods of storage, store at -20 deg C. Avoid repeat freeze-thaw cycles.

General Information

Biological Significance SEC23B is a member of the SEC23 subfamily of the SEC23/SEC24 family, which is involved in vesicle trafficking. SEC23B has similarity to yeast Sec23p component of COPII. COPII is the coat protein complex responsible for vesicle budding from the ER. The function SEC23B has been implicated in cargo selection and concentration.

References
Add a Paper

Sorry, but there are no references currently for this product.

Reviews

You need to be logged in to write a review. Please login here

Sorry there are currently no reviews for this product

Images

  • Western Blot analysis using SEC23B antibody (70R-3255) | SEC23B antibody (70R-3255) used at 1 ug/ml to detect target protein.

Availability: In stock

Price: £250.71
Size: 50 ug
OR
Shipping
View Our Distributors